In this chapter we’ll discuss in more detail the Bio.SeqIO module,
which was briefly introduced in
Chapter :ref:`chapter:quick_start` and also used
in Chapter :ref:`chapter:seq_annot`. This aims to
provide a simple interface for working with assorted sequence file
formats in a uniform way. See also the Bio.SeqIO wiki page
(http://biopython.org/wiki/SeqIO), and the built-in documentation
:py:mod:`Bio.Seq`:
>>> from Bio import SeqIO
>>> help(SeqIO)The “catch” is that you have to work with SeqRecord objects (see
Chapter :ref:`chapter:seq_annot`), which contain a
Seq object (see
Chapter :ref:`chapter:seq_objects`) plus
annotation like an identifier and description. Note that when dealing
with very large FASTA or FASTQ files, the overhead of working with all
these objects can make scripts too slow. In this case consider the
low-level SimpleFastaParser and FastqGeneralIterator parsers
which return just a tuple of strings for each record (see
Section :ref:`sec:low-level-fasta-fastq`).
The workhorse function Bio.SeqIO.parse() is used to read in sequence
data as SeqRecord objects. This function expects two arguments:
- The first argument is a handle to read the data from, or a filename. A handle is typically a file opened for reading, but could be the output from a command line program, or data downloaded from the internet (see Section :ref:`sec:SeqIO_Online`). See Section :ref:`sec:appendix-handles` for more about handles.
- The second argument is a lower case string specifying sequence format – we don’t try and guess the file format for you! See http://biopython.org/wiki/SeqIO for a full listing of supported formats.
The Bio.SeqIO.parse() function returns an iterator which gives
SeqRecord objects. Iterators are typically used in a for loop as
shown below.
Sometimes you’ll find yourself dealing with files which contain only a
single record. For this situation use the function Bio.SeqIO.read()
which takes the same arguments. Provided there is one and only one
record in the file, this is returned as a SeqRecord object.
Otherwise an exception is raised.
In general Bio.SeqIO.parse() is used to read in sequence files as
SeqRecord objects, and is typically used with a for loop like this:
from Bio import SeqIO
for seq_record in SeqIO.parse("ls_orchid.fasta", "fasta"):
print(seq_record.id)
print(repr(seq_record.seq))
print(len(seq_record))The above example is repeated from the introduction in Section :ref:`sec:sequence-parsing`, and will load the orchid DNA sequences in the FASTA format file ls_orchid.fasta. If instead you wanted to load a GenBank format file like ls_orchid.gbk then all you need to do is change the filename and the format string:
from Bio import SeqIO
for seq_record in SeqIO.parse("ls_orchid.gbk", "genbank"):
print(seq_record.id)
print(repr(seq_record.seq))
print(len(seq_record))Similarly, if you wanted to read in a file in another file format, then
assuming Bio.SeqIO.parse() supports it you would just need to change
the format string as appropriate, for example “swiss” for SwissProt
files or “embl” for EMBL text files. There is a full listing on the wiki
page (http://biopython.org/wiki/SeqIO) and in the built-in documentation
:py:mod:`Bio.SeqIO`:
Another very common way to use a Python iterator is within a list comprehension (or a generator expression). For example, if all you wanted to extract from the file was a list of the record identifiers we can easily do this with the following list comprehension:
>>> from Bio import SeqIO
>>> identifiers = [seq_record.id for seq_record in SeqIO.parse("ls_orchid.gbk", "genbank")]
>>> identifiers
['Z78533.1', 'Z78532.1', 'Z78531.1', 'Z78530.1', 'Z78529.1', 'Z78527.1', ..., 'Z78439.1']There are more examples using SeqIO.parse() in a list comprehension
like this in
Section :ref:`sec:sequence-parsing-plus-pyplot`
(e.g. for plotting sequence lengths or GC%).
In the above examples, we have usually used a for loop to iterate over all the records one by one. You can use the for loop with all sorts of Python objects (including lists, tuples and strings) which support the iteration interface.
The object returned by Bio.SeqIO is actually an iterator which
returns SeqRecord objects. You get to see each record in turn, but
once and only once. The plus point is that an iterator can save you
memory when dealing with large files.
Instead of using a for loop, can also use the next() function on an
iterator to step through the entries, like this:
from Bio import SeqIO
record_iterator = SeqIO.parse("ls_orchid.fasta", "fasta")
first_record = next(record_iterator)
print(first_record.id)
print(first_record.description)
second_record = next(record_iterator)
print(second_record.id)
print(second_record.description)Note that if you try to use next() and there are no more results,
you’ll get the special StopIteration exception.
One special case to consider is when your sequence files have multiple records, but you only want the first one. In this situation the following code is very concise:
from Bio import SeqIO
first_record = next(SeqIO.parse("ls_orchid.gbk", "genbank"))A word of warning here – using the next() function like this will
silently ignore any additional records in the file. If your files have
one and only one record, like some of the online examples later in
this chapter, or a GenBank file for a single chromosome, then use the
new Bio.SeqIO.read() function instead. This will check there are no
extra unexpected records present.
In the previous section we talked about the fact that
Bio.SeqIO.parse() gives you a SeqRecord iterator, and that you
get the records one by one. Very often you need to be able to access the
records in any order. The Python list data type is perfect for this,
and we can turn the record iterator into a list of SeqRecord objects
using the built-in Python function list() like so:
from Bio import SeqIO
records = list(SeqIO.parse("ls_orchid.gbk", "genbank"))
print("Found %i records" % len(records))
print("The last record")
last_record = records[-1] # using Python's list tricks
print(last_record.id)
print(repr(last_record.seq))
print(len(last_record))
print("The first record")
first_record = records[0] # remember, Python counts from zero
print(first_record.id)
print(repr(first_record.seq))
print(len(first_record))Giving:
Found 94 records
The last record
Z78439.1
Seq('CATTGTTGAGATCACATAATAATTGATCGAGTTAATCTGGAGGATCTGTTTACT...GCC')
592
The first record
Z78533.1
Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGATGAGACCGTGG...CGC')
740
You can of course still use a for loop with a list of SeqRecord
objects. Using a list is much more flexible than an iterator (for
example, you can determine the number of records from the length of the
list), but does need more memory because it will hold all the records in
memory at once.
The SeqRecord object and its annotation structures are described
more fully in Chapter :ref:`chapter:seq_annot`. As
an example of how annotations are stored, we’ll look at the output from
parsing the first record in the GenBank file
ls_orchid.gbk.
from Bio import SeqIO
record_iterator = SeqIO.parse("ls_orchid.gbk", "genbank")
first_record = next(record_iterator)
print(first_record)That should give something like this:
ID: Z78533.1
Name: Z78533
Description: C.irapeanum 5.8S rRNA gene and ITS1 and ITS2 DNA.
Number of features: 5
/sequence_version=1
/source=Cypripedium irapeanum
/taxonomy=['Eukaryota', 'Viridiplantae', 'Streptophyta', ..., 'Cypripedium']
/keywords=['5.8S ribosomal RNA', '5.8S rRNA gene', ..., 'ITS1', 'ITS2']
/references=[...]
/accessions=['Z78533']
/data_file_division=PLN
/date=30-NOV-2006
/organism=Cypripedium irapeanum
/gi=2765658
Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGATGAGACCGTGG...CGC')
This gives a human readable summary of most of the annotation data for
the SeqRecord. For this example we’re going to use the
.annotations attribute which is just a Python dictionary. The
contents of this annotations dictionary were shown when we printed the
record above. You can also print them out directly:
print(first_record.annotations)Like any Python dictionary, you can easily get the keys:
print(first_record.annotations.keys())or values:
print(first_record.annotations.values())In general, the annotation values are strings, or lists of strings. One special case is any references in the file get stored as reference objects.
Suppose you wanted to extract a list of the species from the ls_orchid.gbk GenBank file. The information we want, Cypripedium irapeanum, is held in the annotations dictionary under ‘source’ and ‘organism’, which we can access like this:
>>> print(first_record.annotations["source"])
Cypripedium irapeanumor:
>>> print(first_record.annotations["organism"])
Cypripedium irapeanumIn general, ‘organism’ is used for the scientific name (in Latin, e.g. Arabidopsis thaliana), while ‘source’ will often be the common name (e.g. thale cress). In this example, as is often the case, the two fields are identical.
Now let’s go through all the records, building up a list of the species each orchid sequence is from:
from Bio import SeqIO
all_species = []
for seq_record in SeqIO.parse("ls_orchid.gbk", "genbank"):
all_species.append(seq_record.annotations["organism"])
print(all_species)Another way of writing this code is to use a list comprehension:
from Bio import SeqIO
all_species = [
seq_record.annotations["organism"]
for seq_record in SeqIO.parse("ls_orchid.gbk", "genbank")
]
print(all_species)In either case, the result is:
['Cypripedium irapeanum', 'Cypripedium californicum', ..., 'Paphiopedilum barbatum']
Great. That was pretty easy because GenBank files are annotated in a standardized way.
Now, let’s suppose you wanted to extract a list of the species from a FASTA file, rather than the GenBank file. The bad news is you will have to write some code to extract the data you want from the record’s description line - if the information is in the file in the first place! Our example FASTA format file ls_orchid.fasta starts like this:
>gi|2765658|emb|Z78533.1|CIZ78533 C.irapeanum 5.8S rRNA gene and ITS1 and ITS2 DNA
CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGATGAGACCGTGGAATAAACGATCGAGTG
AATCCGGAGGACCGGTGTACTCAGCTCACCGGGGGCATTGCTCCCGTGGTGACCCTGATTTGTTGTTGGG
...
You can check by hand, but for every record the species name is in the
description line as the second word. This means if we break up each
record’s .description at the spaces, then the species is there as
field number one (field zero is the record identifier). That means we
can do this:
>>> from Bio import SeqIO
>>> all_species = []
>>> for seq_record in SeqIO.parse("ls_orchid.fasta", "fasta"):
... all_species.append(seq_record.description.split()[1])
...
>>> print(all_species)
['C.irapeanum', 'C.californicum', 'C.fasciculatum', ..., 'P.barbatum']The concise alternative using list comprehensions would be:
>>> from Bio import SeqIO
>>> all_species = [
... seq_record.description.split()[1]
... for seq_record in SeqIO.parse("ls_orchid.fasta", "fasta")
... ]
>>> print(all_species)
['C.irapeanum', 'C.californicum', 'C.fasciculatum', ..., 'P.barbatum']In general, extracting information from the FASTA description line is not very nice. If you can get your sequences in a well annotated file format like GenBank or EMBL, then this sort of annotation information is much easier to deal with.
In the previous section, we demonstrated how to extract data from a
SeqRecord. Another common task is to alter this data. The attributes
of a SeqRecord can be modified directly, for example:
>>> from Bio import SeqIO
>>> record_iterator = SeqIO.parse("ls_orchid.fasta", "fasta")
>>> first_record = next(record_iterator)
>>> first_record.id
'gi|2765658|emb|Z78533.1|CIZ78533'
>>> first_record.id = "new_id"
>>> first_record.id
'new_id'Note, if you want to change the way FASTA is output when written to a
file (see Section :ref:`sec:writing-sequence-files`), then you
should modify both the id and description attributes. To ensure
the correct behavior, it is best to include the id plus a space at
the start of the desired description:
>>> from Bio import SeqIO
>>> record_iterator = SeqIO.parse("ls_orchid.fasta", "fasta")
>>> first_record = next(record_iterator)
>>> first_record.id = "new_id"
>>> first_record.description = first_record.id + " " + "desired new description"
>>> print(first_record.format("fasta")[:200])
>new_id desired new description
CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGATGAGACCGTGGAATAAA
CGATCGAGTGAATCCGGAGGACCGGTGTACTCAGCTCACCGGGGGCATTGCTCCCGTGGT
GACCCTGATTTGTTGTTGGGCCGCCTCGGGAGCGTCCATGGCGGGTIn the previous section, we looked at parsing sequence data from a file.
Instead of using a filename, you can give Bio.SeqIO a handle (see
Section :ref:`sec:appendix-handles`), and in this
section we’ll use handles to parse sequence from compressed files.
As you’ll have seen above, we can use Bio.SeqIO.read() or
Bio.SeqIO.parse() with a filename - for instance this quick example
calculates the total length of the sequences in a multiple record
GenBank file using a generator expression:
>>> from Bio import SeqIO
>>> print(sum(len(r) for r in SeqIO.parse("ls_orchid.gbk", "gb")))
67518Here we use a file handle instead, using the with statement to close
the handle automatically:
>>> from Bio import SeqIO
>>> with open("ls_orchid.gbk") as handle:
... print(sum(len(r) for r in SeqIO.parse(handle, "gb")))
...
67518Or, the old fashioned way where you manually close the handle:
>>> from Bio import SeqIO
>>> handle = open("ls_orchid.gbk")
>>> print(sum(len(r) for r in SeqIO.parse(handle, "gb")))
67518
>>> handle.close()Now, suppose we have a gzip compressed file instead? These are very
commonly used on Linux. We can use Python’s gzip module to open the
compressed file for reading - which gives us a handle object:
>>> import gzip
>>> from Bio import SeqIO
>>> with gzip.open("ls_orchid.gbk.gz", "rt") as handle:
... print(sum(len(r) for r in SeqIO.parse(handle, "gb")))
...
67518Similarly if we had a bzip2 compressed file:
>>> import bz2
>>> from Bio import SeqIO
>>> with bz2.open("ls_orchid.gbk.bz2", "rt") as handle:
... print(sum(len(r) for r in SeqIO.parse(handle, "gb")))
...
67518There is a gzip (GNU Zip) variant called BGZF (Blocked GNU Zip Format), which can be treated like an ordinary gzip file for reading, but has advantages for random access later which we’ll talk about later in Section :ref:`sec:SeqIO-index-bgzf`.
In the previous sections, we looked at parsing sequence data from a file
(using a filename or handle), and from compressed files (using a
handle). Here we’ll use Bio.SeqIO with another type of handle, a
network connection, to download and parse sequences from the internet.
Note that just because you can download sequence data and parse it
into a SeqRecord object in one go doesn’t mean this is a good idea.
In general, you should probably download sequences once and save them
to a file for reuse.
Section :ref:`sec:efetch` talks about the Entrez EFetch interface in more detail, but for now let’s just connect to the NCBI and get a few Opuntia (prickly-pear) sequences from GenBank using their GI numbers.
First of all, let’s fetch just one record. If you don’t care about the
annotations and features downloading a FASTA file is a good choice as
these are compact. Now remember, when you expect the handle to contain
one and only one record, use the Bio.SeqIO.read() function:
from Bio import Entrez
from Bio import SeqIO
Entrez.email = "A.N.Other@example.com"
with Entrez.efetch(
db="nucleotide", rettype="fasta", retmode="text", id="6273291"
) as handle:
seq_record = SeqIO.read(handle, "fasta")
print("%s with %i features" % (seq_record.id, len(seq_record.features)))Expected output:
gi|6273291|gb|AF191665.1|AF191665 with 0 features
The NCBI will also let you ask for the file in other formats, in
particular as a GenBank file. Until Easter 2009, the Entrez EFetch API
let you use “genbank” as the return type, however the NCBI now insist on
using the official return types of “gb” (or “gp” for proteins) as
described on EFetch for Sequence and other Molecular Biology
Databases. As a result,
in Biopython 1.50 onwards, we support “gb” as an alias for “genbank” in
Bio.SeqIO.
from Bio import Entrez
from Bio import SeqIO
Entrez.email = "A.N.Other@example.com"
with Entrez.efetch(
db="nucleotide", rettype="gb", retmode="text", id="6273291"
) as handle:
seq_record = SeqIO.read(handle, "gb") # using "gb" as an alias for "genbank"
print("%s with %i features" % (seq_record.id, len(seq_record.features)))The expected output of this example is:
AF191665.1 with 3 features
Notice this time we have three features.
Now let’s fetch several records. This time the handle contains multiple
records, so we must use the Bio.SeqIO.parse() function:
from Bio import Entrez
from Bio import SeqIO
Entrez.email = "A.N.Other@example.com"
with Entrez.efetch(
db="nucleotide", rettype="gb", retmode="text", id="6273291,6273290,6273289"
) as handle:
for seq_record in SeqIO.parse(handle, "gb"):
print("%s %s..." % (seq_record.id, seq_record.description[:50]))
print(
"Sequence length %i, %i features, from: %s"
% (
len(seq_record),
len(seq_record.features),
seq_record.annotations["source"],
)
)That should give the following output:
AF191665.1 Opuntia marenae rpl16 gene; chloroplast gene for c...
Sequence length 902, 3 features, from: chloroplast Opuntia marenae
AF191664.1 Opuntia clavata rpl16 gene; chloroplast gene for c...
Sequence length 899, 3 features, from: chloroplast Grusonia clavata
AF191663.1 Opuntia bradtiana rpl16 gene; chloroplast gene for...
Sequence length 899, 3 features, from: chloroplast Opuntia bradtianaa
See Chapter :ref:`chapter:entrez` for more about the
Bio.Entrez module, and make sure to read about the NCBI guidelines
for using Entrez
(Section :ref:`sec:entrez-guidelines`).
Now let’s use a handle to download a SwissProt file from ExPASy,
something covered in more depth in
Chapter :ref:`chapter:uniprot`. As mentioned above,
when you expect the handle to contain one and only one record, use the
Bio.SeqIO.read() function:
from Bio import ExPASy
from Bio import SeqIO
with ExPASy.get_sprot_raw("O23729") as handle:
seq_record = SeqIO.read(handle, "swiss")
print(seq_record.id)
print(seq_record.name)
print(seq_record.description)
print(repr(seq_record.seq))
print("Length %i" % len(seq_record))
print(seq_record.annotations["keywords"])Assuming your network connection is OK, you should get back:
O23729
CHS3_BROFI
RecName: Full=Chalcone synthase 3; EC=2.3.1.74; AltName: Full=Naringenin-chalcone synthase 3;
Seq('MAPAMEEIRQAQRAEGPAAVLAIGTSTPPNALYQADYPDYYFRITKSEHLTELK...GAE')
Length 394
['Acyltransferase', 'Flavonoid biosynthesis', 'Transferase']
Looping over the iterator returned by SeqIO.parse once will exhaust
the file. For self-indexed files, such as files in the twoBit format,
the return value of SeqIO.parse can also be used as a dictionary,
allowing random access to the sequence contents. As in this case parsing
is done on demand, the file must remain open as long as the sequence
data is being accessed:
>>> from Bio import SeqIO
>>> handle = open("sequence.bigendian.2bit", "rb")
>>> records = SeqIO.parse(handle, "twobit")
>>> records.keys()
dict_keys(['seq11111', 'seq222', 'seq3333', 'seq4', 'seq555', 'seq6'])
>>> records["seq222"]
SeqRecord(seq=Seq('TTGATCGGTGACAAATTTTTTACAAAGAACTGTAGGACTTGCTACTTCTCCCTC...ACA'), id='seq222', name='<unknown name>', description='<unknown description>', dbxrefs=[])
>>> records["seq222"].seq
Seq('TTGATCGGTGACAAATTTTTTACAAAGAACTGTAGGACTTGCTACTTCTCCCTC...ACA')
>>> handle.close()
>>> records["seq222"].seq
Traceback (most recent call last):
...
ValueError: cannot retrieve sequence: file is closedFor other file formats, Bio.SeqIO provides three related functions
module which allow dictionary like random access to a multi-sequence
file. There is a trade off here between flexibility and memory usage. In
summary:
Bio.SeqIO.to_dict()is the most flexible but also the most memory demanding option (see Section :ref:`sec:seqio_todict`). This is basically a helper function to build a normal Pythondictionarywith each entry held as aSeqRecordobject in memory, allowing you to modify the records.Bio.SeqIO.index()is a useful middle ground, acting like a read only dictionary and parsing sequences intoSeqRecordobjects on demand (see Section :ref:`sec:SeqIO-index`).Bio.SeqIO.index_db()also acts like a read only dictionary but stores the identifiers and file offsets in a file on disk (as an SQLite3 database), meaning it has very low memory requirements (see Section :ref:`sec:SeqIO-index-db`), but will be a little bit slower.
See the discussion for an broad overview (Section :ref:`sec:SeqIO-indexing-discussion`).
The next thing that we’ll do with our ubiquitous orchid files is to show
how to index them and access them like a database using the Python
dictionary data type (like a hash in Perl). This is very useful for
moderately large files where you only need to access certain elements of
the file, and makes for a nice quick ’n dirty database. For dealing with
larger files where memory becomes a problem, see
Section :ref:`sec:SeqIO-index` below.
You can use the function Bio.SeqIO.to_dict() to make a SeqRecord
dictionary (in memory). By default this will use each record’s
identifier (i.e. the .id attribute) as the key. Let’s try this using
our GenBank file:
>>> from Bio import SeqIO
>>> orchid_dict = SeqIO.to_dict(SeqIO.parse("ls_orchid.gbk", "genbank"))There is just one required argument for Bio.SeqIO.to_dict(), a list
or generator giving SeqRecord objects. Here we have just used the
output from the SeqIO.parse function. As the name suggests, this
returns a Python dictionary.
Since this variable orchid_dict is an ordinary Python dictionary, we
can look at all of the keys we have available:
>>> len(orchid_dict)
94>>> list(orchid_dict.keys())
['Z78484.1', 'Z78464.1', 'Z78455.1', 'Z78442.1', 'Z78532.1', 'Z78453.1', ..., 'Z78471.1']Under Python 3 the dictionary methods like “.keys()“ and “.values()“ are iterators rather than lists.
If you really want to, you can even look at all the records at once:
>>> list(orchid_dict.values()) # lots of output!We can access a single SeqRecord object via the keys and manipulate
the object as normal:
>>> seq_record = orchid_dict["Z78475.1"]
>>> print(seq_record.description)
P.supardii 5.8S rRNA gene and ITS1 and ITS2 DNA
>>> seq_record.seq
Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...GGT')So, it is very easy to create an in memory “database” of our GenBank records. Next we’ll try this for the FASTA file instead.
Note that those of you with prior Python experience should all be able
to construct a dictionary like this “by hand”. However, typical
dictionary construction methods will not deal with the case of repeated
keys very nicely. Using the Bio.SeqIO.to_dict() will explicitly
check for duplicate keys, and raise an exception if any are found.
Using the same code as above, but for the FASTA file instead:
from Bio import SeqIO
orchid_dict = SeqIO.to_dict(SeqIO.parse("ls_orchid.fasta", "fasta"))
print(orchid_dict.keys())This time the keys are:
['gi|2765596|emb|Z78471.1|PDZ78471', 'gi|2765646|emb|Z78521.1|CCZ78521', ...
..., 'gi|2765613|emb|Z78488.1|PTZ78488', 'gi|2765583|emb|Z78458.1|PHZ78458']
You should recognize these strings from when we parsed the FASTA file
earlier in Section :ref:`sec:fasta-parsing`. Suppose
you would rather have something else as the keys - like the accession
numbers. This brings us nicely to SeqIO.to_dict()’s optional
argument key_function, which lets you define what to use as the
dictionary key for your records.
First you must write your own function to return the key you want (as a
string) when given a SeqRecord object. In general, the details of
function will depend on the sort of input records you are dealing with.
But for our orchids, we can just split up the record’s identifier using
the “pipe” character (the vertical line) and return the fourth entry
(field three):
def get_accession(record):
"""Given a SeqRecord, return the accession number as a string.
e.g. "gi|2765613|emb|Z78488.1|PTZ78488" -> "Z78488.1"
"""
parts = record.id.split("|")
assert len(parts) == 5 and parts[0] == "gi" and parts[2] == "emb"
return parts[3]Then we can give this function to the SeqIO.to_dict() function to
use in building the dictionary:
from Bio import SeqIO
orchid_dict = SeqIO.to_dict(
SeqIO.parse("ls_orchid.fasta", "fasta"), key_function=get_accession
)
print(orchid_dict.keys())Finally, as desired, the new dictionary keys:
>>> print(orchid_dict.keys())
['Z78484.1', 'Z78464.1', 'Z78455.1', 'Z78442.1', 'Z78532.1', 'Z78453.1', ..., 'Z78471.1']Not too complicated, I hope!
To give another example of working with dictionaries of SeqRecord
objects, we’ll use the SEGUID checksum function. This is a relatively
recent checksum, and collisions should be very rare (i.e. two different
sequences with the same checksum), an improvement on the CRC64 checksum.
Once again, working with the orchids GenBank file:
from Bio import SeqIO
from Bio.SeqUtils.CheckSum import seguid
for record in SeqIO.parse("ls_orchid.gbk", "genbank"):
print(record.id, seguid(record.seq))This should give:
Z78533.1 JUEoWn6DPhgZ9nAyowsgtoD9TTo
Z78532.1 MN/s0q9zDoCVEEc+k/IFwCNF2pY
...
Z78439.1 H+JfaShya/4yyAj7IbMqgNkxdxQ
Now, recall the Bio.SeqIO.to_dict() function’s key_function
argument expects a function which turns a SeqRecord into a string.
We can’t use the seguid() function directly because it expects to be
given a Seq object (or a string). However, we can use Python’s
lambda feature to create a “one off” function to give to
Bio.SeqIO.to_dict() instead:
>>> from Bio import SeqIO
>>> from Bio.SeqUtils.CheckSum import seguid
>>> seguid_dict = SeqIO.to_dict(
... SeqIO.parse("ls_orchid.gbk", "genbank"), lambda rec: seguid(rec.seq)
... )
>>> record = seguid_dict["MN/s0q9zDoCVEEc+k/IFwCNF2pY"]
>>> print(record.id)
Z78532.1
>>> print(record.description)
C.californicum 5.8S rRNA gene and ITS1 and ITS2 DNAThat should have retrieved the record Z78532.1, the second entry in
the file.
As the previous couple of examples tried to illustrate, using
Bio.SeqIO.to_dict() is very flexible. However, because it holds
everything in memory, the size of file you can work with is limited by
your computer’s RAM. In general, this will only work on small to medium
files.
For larger files you should consider Bio.SeqIO.index(), which works
a little differently. Although it still returns a dictionary like
object, this does not keep everything in memory. Instead, it just
records where each record is within the file – when you ask for a
particular record, it then parses it on demand.
As an example, let’s use the same GenBank file as before:
>>> from Bio import SeqIO
>>> orchid_dict = SeqIO.index("ls_orchid.gbk", "genbank")
>>> len(orchid_dict)
94>>> orchid_dict.keys()
['Z78484.1', 'Z78464.1', 'Z78455.1', 'Z78442.1', 'Z78532.1', 'Z78453.1', ..., 'Z78471.1']>>> seq_record = orchid_dict["Z78475.1"]
>>> print(seq_record.description)
P.supardii 5.8S rRNA gene and ITS1 and ITS2 DNA
>>> seq_record.seq
Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...GGT')
>>> orchid_dict.close()Note that Bio.SeqIO.index() won’t take a handle, but only a
filename. There are good reasons for this, but it is a little technical.
The second argument is the file format (a lower case string as used in
the other Bio.SeqIO functions). You can use many other simple file
formats, including FASTA and FASTQ files (see the example in
Section :ref:`sec:fastq-indexing`). However,
alignment formats like PHYLIP or Clustal are not supported. Finally as
an optional argument you can supply a key function.
Here is the same example using the FASTA file - all we change is the filename and the format name:
>>> from Bio import SeqIO
>>> orchid_dict = SeqIO.index("ls_orchid.fasta", "fasta")
>>> len(orchid_dict)
94
>>> orchid_dict.keys()
['gi|2765596|emb|Z78471.1|PDZ78471', 'gi|2765646|emb|Z78521.1|CCZ78521', ...
..., 'gi|2765613|emb|Z78488.1|PTZ78488', 'gi|2765583|emb|Z78458.1|PHZ78458']Suppose you want to use the same keys as before? Much like with the
Bio.SeqIO.to_dict() example in
Section :ref:`sec:seqio-todict-functionkey`, you’ll need to
write a tiny function to map from the FASTA identifier (as a string) to
the key you want:
def get_acc(identifier):
"""Given a SeqRecord identifier string, return the accession number as a string.
e.g. "gi|2765613|emb|Z78488.1|PTZ78488" -> "Z78488.1"
"""
parts = identifier.split("|")
assert len(parts) == 5 and parts[0] == "gi" and parts[2] == "emb"
return parts[3]Then we can give this function to the Bio.SeqIO.index() function to
use in building the dictionary:
>>> from Bio import SeqIO
>>> orchid_dict = SeqIO.index("ls_orchid.fasta", "fasta", key_function=get_acc)
>>> print(orchid_dict.keys())
['Z78484.1', 'Z78464.1', 'Z78455.1', 'Z78442.1', 'Z78532.1', 'Z78453.1', ..., 'Z78471.1']Easy when you know how?
The dictionary-like object from Bio.SeqIO.index() gives you each
entry as a SeqRecord object. However, it is sometimes useful to be
able to get the original raw data straight from the file. For this use
the get_raw() method which takes a single argument (the record
identifier) and returns a bytes string (extracted from the file without
modification).
A motivating example is extracting a subset of a records from a large
file where either Bio.SeqIO.write() does not (yet) support the
output file format (e.g. the plain text SwissProt file format) or where
you need to preserve the text exactly (e.g. GenBank or EMBL output from
Biopython does not yet preserve every last bit of annotation).
Let’s suppose you have download the whole of UniProt in the plain text
SwissPort file format from their FTP site
(ftp://ftp.uniprot.org/pub/databases/uniprot/current_release/knowledgebase/complete/uniprot_sprot.dat.gz)
and uncompressed it as the file uniprot_sprot.dat, and you want to
extract just a few records from it:
>>> from Bio import SeqIO
>>> uniprot = SeqIO.index("uniprot_sprot.dat", "swiss")
>>> with open("selected.dat", "wb") as out_handle:
... for acc in ["P33487", "P19801", "P13689", "Q8JZQ5", "Q9TRC7"]:
... out_handle.write(uniprot.get_raw(acc))
...Note with Python 3 onwards, we have to open the file for writing in
binary mode because the get_raw() method returns bytes strings.
There is a longer example in
Section :ref:`sec:SeqIO-sort` using the
SeqIO.index() function to sort a large sequence file (without
loading everything into memory at once).
Biopython 1.57 introduced an alternative, Bio.SeqIO.index_db(),
which can work on even extremely large files since it stores the record
information as a file on disk (using an SQLite3 database) rather than in
memory. Also, you can index multiple files together (providing all the
record identifiers are unique).
The Bio.SeqIO.index() function takes three required arguments:
- Index filename, we suggest using something ending
.idx. This index file is actually an SQLite3 database. - List of sequence filenames to index (or a single filename)
- File format (lower case string as used in the rest of the
SeqIOmodule).
As an example, consider the GenBank flat file releases from the NCBI FTP site, ftp://ftp.ncbi.nih.gov/genbank/, which are gzip compressed GenBank files.
As of GenBank release 210, there are 38 files making up
the viral sequences, gbvrl1.seq, …, gbvrl38.seq, taking about
8GB on disk once decompressed, and containing in total nearly two
million records.
If you were interested in the viruses, you could download all the virus
files from the command line very easily with the rsync command, and
then decompress them with gunzip:
# For illustration only, see reduced example below
$ rsync -avP "ftp.ncbi.nih.gov::genbank/gbvrl*.seq.gz" .
$ gunzip gbvrl*.seq.gzUnless you care about viruses, that’s a lot of data to download just for this example - so let’s download just the first four chunks (about 25MB each compressed), and decompress them (taking in all about 1GB of space):
# Reduced example, download only the first four chunks
$ curl -O ftp://ftp.ncbi.nih.gov/genbank/gbvrl1.seq.gz
$ curl -O ftp://ftp.ncbi.nih.gov/genbank/gbvrl2.seq.gz
$ curl -O ftp://ftp.ncbi.nih.gov/genbank/gbvrl3.seq.gz
$ curl -O ftp://ftp.ncbi.nih.gov/genbank/gbvrl4.seq.gz
$ gunzip gbvrl*.seq.gzNow, in Python, index these GenBank files as follows:
>>> import glob
>>> from Bio import SeqIO
>>> files = glob.glob("gbvrl*.seq")
>>> print("%i files to index" % len(files))
4
>>> gb_vrl = SeqIO.index_db("gbvrl.idx", files, "genbank")
>>> print("%i sequences indexed" % len(gb_vrl))
272960 sequences indexedIndexing the full set of virus GenBank files took about ten minutes on my machine, just the first four files took about a minute or so.
However, once done, repeating this will reload the index file
gbvrl.idx in a fraction of a second.
You can use the index as a read only Python dictionary - without having to worry about which file the sequence comes from, e.g.
>>> print(gb_vrl["AB811634.1"].description)
Equine encephalosis virus NS3 gene, complete cds, isolate: Kimron1.Just as with the Bio.SeqIO.index() function discussed above in
Section :ref:`sec:seqio-index-getraw`, the dictionary like
object also lets you get at the raw bytes of each record:
>>> print(gb_vrl.get_raw("AB811634.1"))
LOCUS AB811634 723 bp RNA linear VRL 17-JUN-2015
DEFINITION Equine encephalosis virus NS3 gene, complete cds, isolate: Kimron1.
ACCESSION AB811634
...
//Very often when you are indexing a sequence file it can be quite large – so you may want to compress it on disk. Unfortunately efficient random access is difficult with the more common file formats like gzip and bzip2. In this setting, BGZF (Blocked GNU Zip Format) can be very helpful. This is a variant of gzip (and can be decompressed using standard gzip tools) popularized by the BAM file format, samtools, and tabix.
To create a BGZF compressed file you can use the command line tool
bgzip which comes with samtools. In our examples we use a filename
extension *.bgz, so they can be distinguished from normal gzipped
files (named *.gz). You can also use the Bio.bgzf module to read
and write BGZF files from within Python.
The Bio.SeqIO.index() and Bio.SeqIO.index_db() can both be used
with BGZF compressed files. For example, if you started with an
uncompressed GenBank file:
>>> from Bio import SeqIO
>>> orchid_dict = SeqIO.index("ls_orchid.gbk", "genbank")
>>> len(orchid_dict)
94
>>> orchid_dict.close()You could compress this (while keeping the original file) at the command line using the following command – but don’t worry, the compressed file is already included with the other example files:
$ bgzip -c ls_orchid.gbk > ls_orchid.gbk.bgzYou can use the compressed file in exactly the same way:
>>> from Bio import SeqIO
>>> orchid_dict = SeqIO.index("ls_orchid.gbk.bgz", "genbank")
>>> len(orchid_dict)
94
>>> orchid_dict.close()or:
>>> from Bio import SeqIO
>>> orchid_dict = SeqIO.index_db("ls_orchid.gbk.bgz.idx", "ls_orchid.gbk.bgz", "genbank")
>>> len(orchid_dict)
94
>>> orchid_dict.close()The SeqIO indexing automatically detects the BGZF compression. Note
that you can’t use the same index file for the uncompressed and
compressed files.
So, which of these methods should you use and why? It depends on what
you are trying to do (and how much data you are dealing with). However,
in general picking Bio.SeqIO.index() is a good starting point. If
you are dealing with millions of records, multiple files, or repeated
analyses, then look at Bio.SeqIO.index_db().
Reasons to choose Bio.SeqIO.to_dict() over either
Bio.SeqIO.index() or Bio.SeqIO.index_db() boil down to a need
for flexibility despite its high memory needs. The advantage of storing
the SeqRecord objects in memory is they can be changed, added to, or
removed at will. In addition to the downside of high memory consumption,
indexing can also take longer because all the records must be fully
parsed.
Both Bio.SeqIO.index() and Bio.SeqIO.index_db() only parse
records on demand. When indexing, they scan the file once looking for
the start of each record and do as little work as possible to extract
the identifier.
Reasons to choose Bio.SeqIO.index() over Bio.SeqIO.index_db()
include:
- Faster to build the index (more noticeable in simple file formats)
- Slightly faster access as SeqRecord objects (but the difference is only really noticeable for simple to parse file formats).
- Can use any immutable Python object as the dictionary keys (e.g. a tuple of strings, or a frozen set) not just strings.
- Don’t need to worry about the index database being out of date if the sequence file being indexed has changed.
Reasons to choose Bio.SeqIO.index_db() over Bio.SeqIO.index()
include:
- Not memory limited – this is already important with files from second
generation sequencing where 10s of millions of sequences are common,
and using
Bio.SeqIO.index()can require more than 4GB of RAM and therefore a 64bit version of Python. - Because the index is kept on disk, it can be reused. Although building the index database file takes longer, if you have a script which will be rerun on the same datafiles in future, this could save time in the long run.
- Indexing multiple files together
- The
get_raw()method can be much faster, since for most file formats the length of each record is stored as well as its offset.
We’ve talked about using Bio.SeqIO.parse() for sequence input
(reading files), and now we’ll look at Bio.SeqIO.write() which is
for sequence output (writing files). This is a function taking three
arguments: some SeqRecord objects, a handle or filename to write to,
and a sequence format.
Here is an example, where we start by creating a few SeqRecord
objects the hard way (by hand, rather than by loading them from a file):
from Bio.Seq import Seq
from Bio.SeqRecord import SeqRecord
rec1 = SeqRecord(
Seq(
"MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSETHLDSMVGQALFGD"
"GAGAVIVGSDPDLSVERPLYELVWTGATLLPDSEGAIDGHLREVGLTFHLLKDVPGLISK"
"NIEKSLKEAFTPLGISDWNSTFWIAHPGGPAILDQVEAKLGLKEEKMRATREVLSEYGNM"
"SSAC",
),
id="gi|14150838|gb|AAK54648.1|AF376133_1",
description="chalcone synthase [Cucumis sativus]",
)
rec2 = SeqRecord(
Seq(
"YPDYYFRITNREHKAELKEKFQRMCDKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQ"
"DMVVVEIPKLGKEAAVKAIKEWGQ",
),
id="gi|13919613|gb|AAK33142.1|",
description="chalcone synthase [Fragaria vesca subsp. bracteata]",
)
rec3 = SeqRecord(
Seq(
"MVTVEEFRRAQCAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC"
"EKSMIKKRYMHLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP"
"KSKITHLVFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAEN"
"NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIIGSDPIPEVERPLFELV"
"SAAQTLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFW"
"IAHPGGPAILDQVELKLGLKQEKLKATRKVLSNYGNMSSACVLFILDEMRKASAKEGLGT"
"TGEGLEWGVLFGFGPGLTVETVVLHSVAT",
),
id="gi|13925890|gb|AAK49457.1|",
description="chalcone synthase [Nicotiana tabacum]",
)
my_records = [rec1, rec2, rec3]Now we have a list of SeqRecord objects, we’ll write them to a FASTA
format file:
from Bio import SeqIO
SeqIO.write(my_records, "my_example.faa", "fasta")And if you open this file in your favorite text editor it should look like this:
>gi|14150838|gb|AAK54648.1|AF376133_1 chalcone synthase [Cucumis sativus]
MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSETHLDSMVGQALFGD
GAGAVIVGSDPDLSVERPLYELVWTGATLLPDSEGAIDGHLREVGLTFHLLKDVPGLISK
NIEKSLKEAFTPLGISDWNSTFWIAHPGGPAILDQVEAKLGLKEEKMRATREVLSEYGNM
SSAC
>gi|13919613|gb|AAK33142.1| chalcone synthase [Fragaria vesca subsp. bracteata]
YPDYYFRITNREHKAELKEKFQRMCDKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQ
DMVVVEIPKLGKEAAVKAIKEWGQ
>gi|13925890|gb|AAK49457.1| chalcone synthase [Nicotiana tabacum]
MVTVEEFRRAQCAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC
EKSMIKKRYMHLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
KSKITHLVFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAEN
NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIIGSDPIPEVERPLFELV
SAAQTLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFW
IAHPGGPAILDQVELKLGLKQEKLKATRKVLSNYGNMSSACVLFILDEMRKASAKEGLGT
TGEGLEWGVLFGFGPGLTVETVVLHSVAT
Suppose you wanted to know how many records the Bio.SeqIO.write()
function wrote to the handle? If your records were in a list you could
just use len(my_records), however you can’t do that when your
records come from a generator/iterator. The Bio.SeqIO.write()
function returns the number of SeqRecord objects written to the
file.
Note - If you tell the Bio.SeqIO.write() function to write to a
file that already exists, the old file will be overwritten without any
warning.
Some people like their parsers to be “round-tripable”, meaning if you
read in a file and write it back out again it is unchanged. This
requires that the parser must extract enough information to reproduce
the original file exactly. Bio.SeqIO does not aim to do this.
As a trivial example, any line wrapping of the sequence data in FASTA
files is allowed. An identical SeqRecord would be given from parsing
the following two examples which differ only in their line breaks:
>YAL068C-7235.2170 Putative promoter sequence
TACGAGAATAATTTCTCATCATCCAGCTTTAACACAAAATTCGCACAGTTTTCGTTAAGA
GAACTTAACATTTTCTTATGACGTAAATGAAGTTTATATATAAATTTCCTTTTTATTGGA
>YAL068C-7235.2170 Putative promoter sequence
TACGAGAATAATTTCTCATCATCCAGCTTTAACACAAAATTCGCA
CAGTTTTCGTTAAGAGAACTTAACATTTTCTTATGACGTAAATGA
AGTTTATATATAAATTTCCTTTTTATTGGA
To make a round-tripable FASTA parser you would need to keep track of where the sequence line breaks occurred, and this extra information is usually pointless. Instead Biopython uses a default line wrapping of 60 characters on output. The same problem with white space applies in many other file formats too. Another issue in some cases is that Biopython does not (yet) preserve every last bit of annotation (e.g. GenBank and EMBL).
Occasionally preserving the original layout (with any quirks it may
have) is important. See Section :ref:`sec:seqio-index-getraw`
about the get_raw() method of the Bio.SeqIO.index()
dictionary-like object for one potential solution.
In previous example we used a list of SeqRecord objects as input to
the Bio.SeqIO.write() function, but it will also accept a
SeqRecord iterator like we get from Bio.SeqIO.parse() – this
lets us do file conversion by combining these two functions.
For this example we’ll read in the GenBank format file ls_orchid.gbk and write it out in FASTA format:
from Bio import SeqIO
records = SeqIO.parse("ls_orchid.gbk", "genbank")
count = SeqIO.write(records, "my_example.fasta", "fasta")
print("Converted %i records" % count)Still, that is a little bit complicated. So, because file conversion is such a common task, there is a helper function letting you replace that with just:
from Bio import SeqIO
count = SeqIO.convert("ls_orchid.gbk", "genbank", "my_example.fasta", "fasta")
print("Converted %i records" % count)The Bio.SeqIO.convert() function will take handles or filenames.
Watch out though – if the output file already exists, it will overwrite
it! To find out more, see the built-in help:
>>> from Bio import SeqIO
>>> help(SeqIO.convert)In principle, just by changing the filenames and the format names, this code could be used to convert between any file formats available in Biopython. However, writing some formats requires information (e.g. quality scores) which other files formats don’t contain. For example, while you can turn a FASTQ file into a FASTA file, you can’t do the reverse. See also Sections :ref:`sec:SeqIO-fastq-conversion` and :ref:`sec:SeqIO-fasta-qual-conversion` in the cookbook chapter which looks at inter-converting between different FASTQ formats.
Finally, as an added incentive for using the Bio.SeqIO.convert()
function (on top of the fact your code will be shorter), doing it this
way may also be faster! The reason for this is the convert function can
take advantage of several file format specific optimizations and tricks.
Suppose you had a file of nucleotide sequences, and you wanted to turn
it into a file containing their reverse complement sequences. This time
a little bit of work is required to transform the SeqRecord objects
we get from our input file into something suitable for saving to our
output file.
To start with, we’ll use Bio.SeqIO.parse() to load some nucleotide
sequences from a file, then print out their reverse complements using
the Seq object’s built-in .reverse_complement() method (see
Section :ref:`sec:seq-reverse-complement`):
>>> from Bio import SeqIO
>>> for record in SeqIO.parse("ls_orchid.gbk", "genbank"):
... print(record.id)
... print(record.seq.reverse_complement())
...Now, if we want to save these reverse complements to a file, we’ll need
to make SeqRecord objects. We can use the SeqRecord object’s
built-in .reverse_complement() method (see
Section :ref:`sec:SeqRecord-reverse-complement`)
but we must decide how to name our new records.
This is an excellent place to demonstrate the power of list comprehensions which make a list in memory:
>>> from Bio import SeqIO
>>> records = [
... rec.reverse_complement(id="rc_" + rec.id, description="reverse complement")
... for rec in SeqIO.parse("ls_orchid.fasta", "fasta")
... ]
>>> len(records)
94Now list comprehensions have a nice trick up their sleeves, you can add a conditional statement:
>>> records = [
... rec.reverse_complement(id="rc_" + rec.id, description="reverse complement")
... for rec in SeqIO.parse("ls_orchid.fasta", "fasta")
... if len(rec) < 700
... ]
>>> len(records)
18That would create an in memory list of reverse complement records where the sequence length was under 700 base pairs. However, we can do exactly the same with a generator expression - but with the advantage that this does not create a list of all the records in memory at once:
>>> records = (
... rec.reverse_complement(id="rc_" + rec.id, description="reverse complement")
... for rec in SeqIO.parse("ls_orchid.fasta", "fasta")
... if len(rec) < 700
... )As a complete example:
>>> from Bio import SeqIO
>>> records = (
... rec.reverse_complement(id="rc_" + rec.id, description="reverse complement")
... for rec in SeqIO.parse("ls_orchid.fasta", "fasta")
... if len(rec) < 700
... )
>>> SeqIO.write(records, "rev_comp.fasta", "fasta")
18There is a related example in Section :ref:`sec:SeqIO-translate`, translating each record in a FASTA file from nucleotides to amino acids.
Suppose that you don’t really want to write your records to a file or
handle – instead you want a string containing the records in a
particular file format. The Bio.SeqIO interface is based on handles,
but Python has a useful built-in module which provides a string based
handle.
For an example of how you might use this, let’s load in a bunch of
SeqRecord objects from our orchids GenBank file, and create a string
containing the records in FASTA format:
from Bio import SeqIO
from io import StringIO
records = SeqIO.parse("ls_orchid.gbk", "genbank")
out_handle = StringIO()
SeqIO.write(records, out_handle, "fasta")
fasta_data = out_handle.getvalue()
print(fasta_data)This isn’t entirely straightforward the first time you see it! On the
bright side, for the special case where you would like a string
containing a single record in a particular file format, use the the
SeqRecord class’ format() method (see
Section :ref:`sec:SeqRecord-format`).
Note that although we don’t encourage it, you can use the format()
method to write to a file, for example something like this:
from Bio import SeqIO
with open("ls_orchid_long.tab", "w") as out_handle:
for record in SeqIO.parse("ls_orchid.gbk", "genbank"):
if len(record) > 100:
out_handle.write(record.format("tab"))While this style of code will work for a simple sequential file format
like FASTA or the simple tab separated format used here, it will not
work for more complex or interlaced file formats. This is why we still
recommend using Bio.SeqIO.write(), as in the following example:
from Bio import SeqIO
records = (rec for rec in SeqIO.parse("ls_orchid.gbk", "genbank") if len(rec) > 100)
SeqIO.write(records, "ls_orchid.tab", "tab")Making a single call to SeqIO.write(...) is also much quicker than
multiple calls to the SeqRecord.format(...) method.
Working with the low-level SimpleFastaParser or
FastqGeneralIterator is often more practical than
Bio.SeqIO.parse when dealing with large high-throughput FASTA or
FASTQ sequencing files where speed matters. As noted in the introduction
to this chapter, the file-format neutral Bio.SeqIO interface has the
overhead of creating many objects even for simple formats like FASTA.
When parsing FASTA files, internally Bio.SeqIO.parse() calls the
low-level SimpleFastaParser with the file handle. You can use this
directly - it iterates over the file handle returning each record as a
tuple of two strings, the title line (everything after the >
character) and the sequence (as a plain string):
>>> from Bio.SeqIO.FastaIO import SimpleFastaParser
>>> count = 0
>>> total_len = 0
>>> with open("ls_orchid.fasta") as in_handle:
... for title, seq in SimpleFastaParser(in_handle):
... count += 1
... total_len += len(seq)
...
>>> print("%i records with total sequence length %i" % (count, total_len))
94 records with total sequence length 67518As long as you don’t care about line wrapping (and you probably don’t for short read high-throughput data), then outputting FASTA format from these strings is also very fast:
...
out_handle.write(">%s\n%s\n" % (title, seq))
...Likewise, when parsing FASTQ files, internally Bio.SeqIO.parse()
calls the low-level FastqGeneralIterator with the file handle. If
you don’t need the quality scores turned into integers, or can work with
them as ASCII strings this is ideal:
>>> from Bio.SeqIO.QualityIO import FastqGeneralIterator
>>> count = 0
>>> total_len = 0
>>> with open("example.fastq") as in_handle:
... for title, seq, qual in FastqGeneralIterator(in_handle):
... count += 1
... total_len += len(seq)
...
>>> print("%i records with total sequence length %i" % (count, total_len))
3 records with total sequence length 75There are more examples of this in the Cookbook (Chapter :ref:`chapter:cookbook`), including how to output FASTQ efficiently from strings using this code snippet:
...
out_handle.write("@%s\n%s\n+\n%s\n" % (title, seq, qual))
...